Lineage for d2hoea3 (2hoe A:72-199)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701817Family c.55.1.10: ROK [110636] (8 proteins)
    Pfam PF00480
  6. 701838Protein N-acetylglucosamine kinase [142469] (1 species)
    Transcriptional regulator, XylR-related
  7. 701839Species Thermotoga maritima [TaxId:2336] [142470] (1 PDB entry)
    TM1224
  8. 701841Domain d2hoea3: 2hoe A:72-199 [136641]
    Other proteins in same PDB: d2hoea1
    complexed with gol, k

Details for d2hoea3

PDB Entry: 2hoe (more details), 2.46 Å

PDB Description: crystal structure of n-acetylglucosamine kinase (tm1224) from thermotoga maritima at 2.46 a resolution
PDB Compounds: (A:) N-acetylglucosamine kinase

SCOP Domain Sequences for d2hoea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hoea3 c.55.1.10 (A:72-199) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]}
pncayvlgievtrdeiaaclidasmnilaheahplpsqsdreetlnvmyriidrakdmme
klgsklsaltvaapgpidtergiiidprnfplsqiplanllkekygievwvendadmgav
gekwytkr

SCOP Domain Coordinates for d2hoea3:

Click to download the PDB-style file with coordinates for d2hoea3.
(The format of our PDB-style files is described here.)

Timeline for d2hoea3: