Lineage for d2hoea1 (2hoe A:10-71)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479776Family a.4.5.63: ROK associated domain [140279] (3 proteins)
    found N-terminal to ROK domain in some proteins
  6. 1479785Protein N-acetylglucosamine kinase [140282] (1 species)
    Transcriptional regulator, XylR-related
  7. 1479786Species Thermotoga maritima [TaxId:2336] [140283] (1 PDB entry)
    Uniprot Q9X0V1 10-71
  8. 1479787Domain d2hoea1: 2hoe A:10-71 [136639]
    Other proteins in same PDB: d2hoea2, d2hoea3
    complexed with gol, k

Details for d2hoea1

PDB Entry: 2hoe (more details), 2.46 Å

PDB Description: crystal structure of n-acetylglucosamine kinase (tm1224) from thermotoga maritima at 2.46 a resolution
PDB Compounds: (A:) N-acetylglucosamine kinase

SCOPe Domain Sequences for d2hoea1:

Sequence, based on SEQRES records: (download)

>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]}
isrilkrimkspvsrvelaeelgltkttvgeiakiflekgivveekdspkgvgrptkslk
is

Sequence, based on observed residues (ATOM records): (download)

>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]}
isrilkrimkspvsrvelaeelgltkttvgeiakiflekgivveekdsprptkslkis

SCOPe Domain Coordinates for d2hoea1:

Click to download the PDB-style file with coordinates for d2hoea1.
(The format of our PDB-style files is described here.)

Timeline for d2hoea1: