SCOP 1.73: Domain d2hoea1: 2hoe A:10-71

Lineage for d2hoea1 (2hoe A:10-71)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.63: ROK associated domain [140279] (3 proteins)
   found N-terminal to ROK domain in some proteins

6. Protein N-acetylglucosamine kinase [140282] (1 species)
   Transcriptional regulator, XylR-related

7. Species Thermotoga maritima [TaxId:2336] [140283] (1 PDB entry)

8. Domain d2hoea1: 2hoe A:10-71 [136639]
   Other proteins in same PDB: d2hoea2, d2hoea3
   complexed with gol, k

Details for d2hoea1

PDB Entry: 2hoe, 2.46 Å

PDB Description: crystal structure of n-acetylglucosamine kinase (tm1224) from thermotoga maritima at 2.46 a resolution

PDB Compounds: (A:) N-acetylglucosamine kinase

SCOP Domain Sequences for d2hoea1:

Sequence, based on SEQRES records:

>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]}
isrilkrimkspvsrvelaeelgltkttvgeiakiflekgivveekdspkgvgrptkslk
is

Sequence, based on observed residues (ATOM records):

>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]}
isrilkrimkspvsrvelaeelgltkttvgeiakiflekgivveekdsprptkslkis

Timeline for d2hoea1:

• d2hoea1 is new in SCOP 1.73
  
• d2hoea1 appears in SCOP 1.75
  
• d2hoea1 appears in the current release, SCOPe 2.08