![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily) dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices |
![]() | Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) ![]() |
![]() | Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins) Pfam PF03271 |
![]() | Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140615] (14 PDB entries) Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254 |
![]() | Domain d2hl5a_: 2hl5 A: [136559] Other proteins in same PDB: d2hl5c_, d2hl5d_ automated match to d1yiga1 complexed with cl; mutant |
PDB Entry: 2hl5 (more details), 1.93 Å
SCOPe Domain Sequences for d2hl5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hl5a_ a.245.1.1 (A:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]} aelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
Timeline for d2hl5a_: