Lineage for d1yiga1 (1yig A:190-255)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helicesSuperfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) 
Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
Pfam PF03271Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species) Species Human (Homo sapiens) [TaxId:9606] [140615] (14 PDB entries)
Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
Domain d1yiga1: 1yig A:190-255 [123291]
Details for d1yiga1
PDB Entry: 1yig (more details), 2 Å
PDB Description: crystal structure of the human eb1 c-terminal dimerization domain
PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1SCOPe Domain Sequences for d1yiga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yiga1 a.245.1.1 (A:190-255) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
ddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrimdilyat
degfvi
SCOPe Domain Coordinates for d1yiga1:
Click to download the PDB-style file with coordinates for d1yiga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yiga1:
- d1yiga1 first appeared in SCOP 1.73
- d1yiga1 appears in SCOPe 2.07
View in 3D
