Lineage for d2hl5c_ (2hl5 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784898Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2784899Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2784924Protein Dynactin 1 [141234] (1 species)
  7. 2784925Species Human (Homo sapiens) [TaxId:9606] [141235] (9 PDB entries)
    Uniprot Q14203 1-99! Uniprot Q14203 25-98
  8. 2784930Domain d2hl5c_: 2hl5 C: [198023]
    Other proteins in same PDB: d2hl5a_, d2hl5b_
    automated match to d2cowa1
    complexed with cl; mutant

Details for d2hl5c_

PDB Entry: 2hl5 (more details), 1.93 Å

PDB Description: crystal structure of the c-terminal domain of human eb1 in complex with the a49m mutant cap-gly domain of human dynactin-1 (p150-glued)
PDB Compounds: (C:) Dynactin-1

SCOPe Domain Sequences for d2hl5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hl5c_ b.34.10.1 (C:) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]}
plrvgsrvevigkghrgtvayvgmtlfatgkwvgvildeakgkndgtvqgrkyftcdegh
gifvrqsqiqvfedga

SCOPe Domain Coordinates for d2hl5c_:

Click to download the PDB-style file with coordinates for d2hl5c_.
(The format of our PDB-style files is described here.)

Timeline for d2hl5c_: