SCOPe 2.08: Domain d2heyr1: 2hey R:83-142

Lineage for d2heyr1 (2hey R:83-142)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (3 families)

5. Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
   Pfam PF00020; TNFR/NGFR cysteine-rich region

6. Protein Tumor necrosis factor receptor superfamily member 4, OX40L receptor, N-terminal and middle domain [419068] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [419559] (3 PDB entries)
   Uniprot P43489

8. Domain d2heyr1: 2hey R:83-142 [136367]
   Other proteins in same PDB: d2heyf_, d2heyg_, d2heyr2, d2heyt2
   automated match to d2hevr1
   complexed with so4
   has additional secondary structure elements or disulfide bonds beyond those in the common domain

Details for d2heyr1

PDB Entry: 2hey, 2 Å

PDB Description: Crystal structure of murine OX40L bound to human OX40

PDB Compounds: (R:) Tumor necrosis factor receptor superfamily member 4

SCOPe Domain Sequences for d2heyr1:

Sequence; same for both SEQRES and ATOM records:

>d2heyr1 g.24.1.1 (R:83-142) Tumor necrosis factor receptor superfamily member 4, OX40L receptor, N-terminal and middle domain {Human (Homo sapiens) [TaxId: 9606]}
pctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqack

Timeline for d2heyr1:

• d2heyr1 first appeared in SCOP 1.73
  
• d2heyr1 appears in SCOPe 2.07