![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
![]() | Superfamily g.24.1: TNF receptor-like [57586] (3 families) ![]() |
![]() | Family g.24.1.1: TNF receptor-like [57587] (13 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
![]() | Protein Tumor necrosis factor receptor superfamily member 4, OX40L receptor, N-terminal and middle domain [419068] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [419559] (3 PDB entries) Uniprot P43489 |
![]() | Domain d2heyr1: 2hey R:83-142 [136367] Other proteins in same PDB: d2heyf_, d2heyg_, d2heyr2, d2heyt2 automated match to d2hevr1 complexed with so4 has additional secondary structure elements or disulfide bonds beyond those in the common domain |
PDB Entry: 2hey (more details), 2 Å
SCOPe Domain Sequences for d2heyr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2heyr1 g.24.1.1 (R:83-142) Tumor necrosis factor receptor superfamily member 4, OX40L receptor, N-terminal and middle domain {Human (Homo sapiens) [TaxId: 9606]} pctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqack
Timeline for d2heyr1: