Lineage for d2heyt3 (2hey T:29-82)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034651Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 3034652Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 3034653Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 3034758Protein Tumor necrosis factor receptor superfamily member 4, OX40L receptor, N-terminal and middle domain [419068] (1 species)
  7. 3034759Species Human (Homo sapiens) [TaxId:9606] [419559] (3 PDB entries)
    Uniprot P43489
  8. 3034763Domain d2heyt3: 2hey T:29-82 [136372]
    Other proteins in same PDB: d2heyf_, d2heyg_, d2heyr2, d2heyt2
    automated match to d2hevr3
    complexed with so4

    has additional secondary structure elements or disulfide bonds beyond those in the common domain

Details for d2heyt3

PDB Entry: 2hey (more details), 2 Å

PDB Description: Crystal structure of murine OX40L bound to human OX40
PDB Compounds: (T:) Tumor necrosis factor receptor superfamily member 4

SCOPe Domain Sequences for d2heyt3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2heyt3 g.24.1.1 (T:29-82) Tumor necrosis factor receptor superfamily member 4, OX40L receptor, N-terminal and middle domain {Human (Homo sapiens) [TaxId: 9606]}
lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpck

SCOPe Domain Coordinates for d2heyt3:

Click to download the PDB-style file with coordinates for d2heyt3.
(The format of our PDB-style files is described here.)

Timeline for d2heyt3: