PDB entry 2hey

View 2hey on RCSB PDB site
Description: Crystal structure of murine OX40L bound to human OX40
Class: cytokine
Keywords: cytokine, receptor-ligan complex, co-stimulator, TNFSF
Deposited on 2006-06-22, released 2006-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: Tumor necrosis factor ligand superfamily member 4
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf4, Ox40l, Txgp1l
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2heyf_
  • Chain 'G':
    Compound: Tumor necrosis factor ligand superfamily member 4
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf4, Ox40l, Txgp1l
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2heyg_
  • Chain 'R':
    Compound: Tumor necrosis factor receptor superfamily member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF4, TXGP1L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2heyr1, d2heyr2, d2heyr3
  • Chain 'T':
    Compound: Tumor necrosis factor receptor superfamily member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF4, TXGP1L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2heyt1, d2heyt2, d2heyt3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2heyF (F:)
    gshmssspakdppiqrlrgavtrcedgqlfissykneyqtmevqnnsvvikcdglyiiyl
    kgsffqevkidlhfredhnpisipmlndgrrivftvvaslafkdkvyltvnapdtlcehl
    qindgelivvqltpgycapegsyhstvnqvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2heyF (F:)
    dppiqrlrgavtrcedgqlfissykneyqtmevqnnsvvikcdglyiiylkgsffqevki
    dlhfredhnpisipmlndgrrivftvvaslafkdkvyltvnapdtlcehlqindgelivv
    qltpgycapegsyhs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2heyG (G:)
    gshmssspakdppiqrlrgavtrcedgqlfissykneyqtmevqnnsvvikcdglyiiyl
    kgsffqevkidlhfredhnpisipmlndgrrivftvvaslafkdkvyltvnapdtlcehl
    qindgelivvqltpgycapegsyhstvnqvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2heyG (G:)
    dppiqrlrgavtrcedgqlfissykneyqtmevqnnsvvikcdglyiiylkgsffqevki
    dlhfredhnpisipmlndgrrivftvvaslafkdkvyltvnapdtlcehlqindgelivv
    qltpgycapegsyh
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2heyR (R:)
    gshmlhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpc
    twcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpw
    tnctlagkhtlqpasnssdaicedrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2heyR (R:)
    lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpctwcn
    lrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpwtnct
    lagkhtlqpasnssdaic
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2heyT (T:)
    gshmlhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpc
    twcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpw
    tnctlagkhtlqpasnssdaicedrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2heyT (T:)
    lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpctwcn
    lrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpwtnct
    latlqpasnssdaic