Class a: All alpha proteins [46456] (290 folds) |
Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily) multihelical; irregular array of long and short helices |
Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) |
Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein) |
Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species) |
Species Pea (Pisum sativum) [TaxId:3888] [81825] (7 PDB entries) |
Domain d2h2eb1: 2h2e B:311-482 [136000] Other proteins in same PDB: d2h2ea2, d2h2ea3, d2h2eb2, d2h2eb3, d2h2ec2, d2h2ec3 automated match to d1p0yb1 complexed with lys, sa8 |
PDB Entry: 2h2e (more details), 2.6 Å
SCOPe Domain Sequences for d2h2eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h2eb1 a.166.1.1 (B:311-482) RuBisCo LSMT C-terminal, substrate-binding domain {Pea (Pisum sativum) [TaxId: 3888]} aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdil
Timeline for d2h2eb1: