![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily) multihelical; irregular array of long and short helices |
![]() | Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) ![]() |
![]() | Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein) |
![]() | Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species) |
![]() | Species Garden pea (Pisum sativum) [TaxId:3888] [81825] (7 PDB entries) |
![]() | Domain d2h2eb1: 2h2e B:311-486 [136000] Other proteins in same PDB: d2h2ea2, d2h2eb2, d2h2ec2 automatically matched to d1mlvb1 complexed with lys, sa8 |
PDB Entry: 2h2e (more details), 2.6 Å
SCOP Domain Sequences for d2h2eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h2eb1 a.166.1.1 (B:311-486) RuBisCo LSMT C-terminal, substrate-binding domain {Garden pea (Pisum sativum) [TaxId: 3888]} aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdilenly
Timeline for d2h2eb1:
![]() Domains from other chains: (mouse over for more information) d2h2ea1, d2h2ea2, d2h2ec1, d2h2ec2 |