PDB entry 2h2e

View 2h2e on RCSB PDB site
Description: Structure of Rubisco LSMT bound to AzaAdoMet and Lysine
Class: transferase
Keywords: SET domain, protein lysine methyltransferase, TRANSFERASE
Deposited on 2006-05-18, released 2006-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase
    Species: Pisum sativum [TaxId:3888]
    Gene: RBCMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43088 (Start-433)
      • cloning artifact (434-437)
    Domains in SCOPe 2.08: d2h2ea1, d2h2ea2, d2h2ea3
  • Chain 'B':
    Compound: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase
    Species: Pisum sativum [TaxId:3888]
    Gene: RBCMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43088 (0-433)
      • cloning artifact (434-439)
    Domains in SCOPe 2.08: d2h2eb1, d2h2eb2, d2h2eb3
  • Chain 'C':
    Compound: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase
    Species: Pisum sativum [TaxId:3888]
    Gene: RBCMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43088 (Start-433)
      • cloning artifact (434-438)
    Domains in SCOPe 2.08: d2h2ec1, d2h2ec2, d2h2ec3
  • Heterogens: SA8, LYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h2eA (A:)
    slspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpd
    avaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqel
    qgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlr
    nenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqyd
    lnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifyn
    rtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksal
    agyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerr
    lkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h2eA (A:)
    lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
    vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
    gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlnl
    vvvpmadlinhsagvttedhayevylfslksplsvkageqvyiqydlnksnaelaldygf
    iepnenrhaytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlv
    alggtdaflleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelk
    egnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdil
    enly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h2eB (B:)
    slspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpd
    avaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqel
    qgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlr
    nenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqyd
    lnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifyn
    rtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksal
    agyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerr
    lkdlglcgengdilenlyfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2h2eC (C:)
    slspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpd
    avaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqel
    qgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlr
    nenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqyd
    lnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifyn
    rtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksal
    agyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerr
    lkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h2eC (C:)
    lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
    vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
    gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
    enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
    nksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifynr
    tlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksala
    gyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerrl
    kdlglcgengdilenlyf