Lineage for d2gtle1 (2gtl E:5-151)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1473270Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) [116752] (1 species)
  7. 1473271Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116753] (2 PDB entries)
    Uniprot P13579
  8. 1473276Domain d2gtle1: 2gtl E:5-151 [135659]
    Other proteins in same PDB: d2gtlb1, d2gtlc1, d2gtld1, d2gtlf1, d2gtlg1, d2gtlh1, d2gtlj1, d2gtlk1, d2gtll1, d2gtlm1, d2gtlm2, d2gtlm3, d2gtln1, d2gtln2, d2gtln3, d2gtlo1, d2gtlo2, d2gtlo3
    automatically matched to d1x9fa_
    complexed with ca, cmo, hem, zn

Details for d2gtle1

PDB Entry: 2gtl (more details), 3.5 Å

PDB Description: Lumbricus Erythrocruorin at 3.5A resolution
PDB Compounds: (E:) Extracellular globin 4

SCOPe Domain Sequences for d2gtle1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtle1 a.1.1.2 (E:5-151) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
dccsyedrreirhiwddvwsssftdrrvaivravfddlfkhyptskalfervkidepesg
efkshlvrvanglkllinllddtlvlqshlghladqhiqrkgvtkeyfrgigeafarvlp
qvlscfnvdawnrcfhrlvariakdlp

SCOPe Domain Coordinates for d2gtle1:

Click to download the PDB-style file with coordinates for d2gtle1.
(The format of our PDB-style files is described here.)

Timeline for d2gtle1: