Class g: Small proteins [56992] (91 folds) |
Fold g.12: LDL receptor-like module [57423] (1 superfamily) disulfide-rich calcium-binding fold |
Superfamily g.12.1: LDL receptor-like module [57424] (2 families) |
Family g.12.1.1: LDL receptor-like module [57425] (6 proteins) |
Protein Extracellular hemoglobin linker l2 subunit [144111] (1 species) |
Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [144112] (1 PDB entry) Uniprot Q2I743 98-138 |
Domain d2gtln2: 2gtl N:61-101 [135671] Other proteins in same PDB: d2gtla1, d2gtlb1, d2gtlc1, d2gtld1, d2gtle1, d2gtlf1, d2gtlg1, d2gtlh1, d2gtli1, d2gtlj1, d2gtlk1, d2gtll1, d2gtlm1, d2gtlm2, d2gtlm3, d2gtln1, d2gtln3, d2gtlo1, d2gtlo2, d2gtlo3 complexed with ca, cmo, hem, zn |
PDB Entry: 2gtl (more details), 3.5 Å
SCOPe Domain Sequences for d2gtln2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} hcekrtfqcggneqecisdllvcdghkdchnahdedpdvcd
Timeline for d2gtln2: