Lineage for d2gtdf2 (2gtd F:122-248)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605994Family c.55.1.13: CoaX-like [142484] (1 protein)
    Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf
  6. 1605995Protein Type III pantothenate kinase, CoaX [142485] (3 species)
  7. 1606010Species Thermotoga maritima [TaxId:2336] [142486] (4 PDB entries)
    Uniprot Q9WZY5 1-118! Uniprot Q9WZY5 119-245
  8. 1606046Domain d2gtdf2: 2gtd F:122-248 [135645]
    automated match to d2gtda2

Details for d2gtdf2

PDB Entry: 2gtd (more details), 2 Å

PDB Description: crystal structure of a type iii pantothenate kinase: insight into the catalysis of an essential coenzyme a biosynthetic enzyme universally distributed in bacteria
PDB Compounds: (F:) Type III pantothenate kinase

SCOPe Domain Sequences for d2gtdf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtdf2 c.55.1.13 (F:122-248) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]}
kngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgkd
teenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltikg
vyhfcfg

SCOPe Domain Coordinates for d2gtdf2:

Click to download the PDB-style file with coordinates for d2gtdf2.
(The format of our PDB-style files is described here.)

Timeline for d2gtdf2: