SCOPe 2.05: Domain d2gtdf2: 2gtd F:122-248

Lineage for d2gtdf2 (2gtd F:122-248)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.13: CoaX-like [142484] (1 protein)
   Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf

6. Protein Type III pantothenate kinase, CoaX [142485] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [142486] (4 PDB entries)
   Uniprot Q9WZY5 1-118! Uniprot Q9WZY5 119-245

8. Domain d2gtdf2: 2gtd F:122-248 [135645]
   automated match to d2gtda2

Details for d2gtdf2

PDB Entry: 2gtd, 2 Å

PDB Description: crystal structure of a type iii pantothenate kinase: insight into the catalysis of an essential coenzyme a biosynthetic enzyme universally distributed in bacteria

PDB Compounds: (F:) Type III pantothenate kinase

SCOPe Domain Sequences for d2gtdf2:

Sequence; same for both SEQRES and ATOM records:

>d2gtdf2 c.55.1.13 (F:122-248) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]}
kngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgkd
teenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltikg
vyhfcfg

Timeline for d2gtdf2:

• d2gtdf2 first appeared in SCOP 1.73
  
• d2gtdf2 appears in SCOPe 2.04
  
• d2gtdf2 appears in SCOPe 2.06
  
• d2gtdf2 appears in the current release, SCOPe 2.08