![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
![]() | Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (29 PDB entries) identical sequence in many other species |
![]() | Domain d2grna_: 2grn A: [135568] Other proteins in same PDB: d2grnb1 automated match to d1u9b__ |
PDB Entry: 2grn (more details), 1.8 Å
SCOPe Domain Sequences for d2grna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grna_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} msgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfkl rmlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqell nepniqdpaqaeaytiycqnrveyekrvraqakkfap
Timeline for d2grna_: