SCOPe 2.01: Domain d2gpsa1: 2gps A:331-446

Lineage for d2gpsa1 (2gps A:331-446)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [51249] (7 PDB entries)

8. Domain d2gpsa1: 2gps A:331-446 [135487]
   Other proteins in same PDB: d2gpsa2, d2gpsa3, d2gpsb2, d2gpsb3
   automatically matched to d1bncb1
   mutant

Details for d2gpsa1

PDB Entry: 2gps, 2.8 Å

PDB Description: crystal structure of the biotin carboxylase subunit, e23r mutant, of acetyl-coa carboxylase from escherichia coli.

PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2gpsa1:

Sequence; same for both SEQRES and ATOM records:

>d2gpsa1 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl

Timeline for d2gpsa1:

• d2gpsa1 first appeared in SCOP 1.73
  
• d2gpsa1 appears in SCOP 1.75
  
• d2gpsa1 appears in SCOPe 2.02
  
• d2gpsa1 appears in the current release, SCOPe 2.08