Lineage for d2gpsa1 (2gps A:331-446)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810794Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 810849Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 810850Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 810857Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 810860Species Escherichia coli [TaxId:562] [51249] (7 PDB entries)
  8. 810875Domain d2gpsa1: 2gps A:331-446 [135487]
    Other proteins in same PDB: d2gpsa2, d2gpsa3, d2gpsb2, d2gpsb3
    automatically matched to d1bncb1
    mutant

Details for d2gpsa1

PDB Entry: 2gps (more details), 2.8 Å

PDB Description: crystal structure of the biotin carboxylase subunit, e23r mutant, of acetyl-coa carboxylase from escherichia coli.
PDB Compounds: (A:) biotin carboxylase

SCOP Domain Sequences for d2gpsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gpsa1 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl

SCOP Domain Coordinates for d2gpsa1:

Click to download the PDB-style file with coordinates for d2gpsa1.
(The format of our PDB-style files is described here.)

Timeline for d2gpsa1: