Lineage for d2gpsb1 (2gps B:331-446)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964158Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 964233Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 964234Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 964241Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 964244Species Escherichia coli [TaxId:562] [51249] (7 PDB entries)
  8. 964260Domain d2gpsb1: 2gps B:331-446 [135490]
    Other proteins in same PDB: d2gpsa2, d2gpsa3, d2gpsb2, d2gpsb3
    automatically matched to d1bncb1
    mutant

Details for d2gpsb1

PDB Entry: 2gps (more details), 2.8 Å

PDB Description: crystal structure of the biotin carboxylase subunit, e23r mutant, of acetyl-coa carboxylase from escherichia coli.
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d2gpsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gpsb1 b.84.2.1 (B:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl

SCOPe Domain Coordinates for d2gpsb1:

Click to download the PDB-style file with coordinates for d2gpsb1.
(The format of our PDB-style files is described here.)

Timeline for d2gpsb1: