Lineage for d2gola_ (2gol A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1494529Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 1494530Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 1494531Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
    automatically mapped to Pfam PF00540
  6. 1494532Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
    topologically similar to one subunit in the interferon-gamma intertwined dimer
  7. 1494533Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (10 PDB entries)
  8. 1494534Domain d2gola_: 2gol A: [135438]
    Other proteins in same PDB: d2golb_, d2gold_
    automated match to d2hmx__
    complexed with so4

Details for d2gola_

PDB Entry: 2gol (more details), 2.2 Å

PDB Description: Xray Structure of Gag278
PDB Compounds: (A:) Matrix protein p17 (MA)

SCOPe Domain Sequences for d2gola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gola_ a.61.1.1 (A:) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]}
svlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlq
pslqtgseelrslyntiavlycvhqridvkdtkealdkieee

SCOPe Domain Coordinates for d2gola_:

Click to download the PDB-style file with coordinates for d2gola_.
(The format of our PDB-style files is described here.)

Timeline for d2gola_: