SCOPe 2.05: Domain d2gola_: 2gol A:

Lineage for d2gola_ (2gol A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
   automatically mapped to Pfam PF00540

6. Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
   topologically similar to one subunit in the interferon-gamma intertwined dimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (10 PDB entries)

8. Domain d2gola_: 2gol A: [135438]
   Other proteins in same PDB: d2golb_, d2gold_
   automated match to d2hmx__
   complexed with so4

Details for d2gola_

PDB Entry: 2gol, 2.2 Å

PDB Description: Xray Structure of Gag278

PDB Compounds: (A:) Matrix protein p17 (MA)

SCOPe Domain Sequences for d2gola_:

Sequence; same for both SEQRES and ATOM records:

>d2gola_ a.61.1.1 (A:) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]}
svlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlq
pslqtgseelrslyntiavlycvhqridvkdtkealdkieee

Timeline for d2gola_:

• d2gola_ first appeared in SCOP 1.73, called d2gola1
  
• d2gola_ appears in SCOPe 2.04
  
• d2gola_ appears in SCOPe 2.06
  
• d2gola_ appears in the current release, SCOPe 2.08