Lineage for d2hmx__ (2hmx -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539870Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 539871Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 539872Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (2 proteins)
  6. 539873Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
    topologically similar to one subunit in the interferon-gamma intertwined dimer
  7. 539874Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (5 PDB entries)
  8. 539884Domain d2hmx__: 2hmx - [18129]

Details for d2hmx__

PDB Entry: 2hmx (more details)

PDB Description: human immunodeficiency virus type 1 matrix protein

SCOP Domain Sequences for d2hmx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmx__ a.61.1.1 (-) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1}
hmgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrq
ilgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaa
adtgnnsqvsqny

SCOP Domain Coordinates for d2hmx__:

Click to download the PDB-style file with coordinates for d2hmx__.
(The format of our PDB-style files is described here.)

Timeline for d2hmx__: