Lineage for d2hmx__ (2hmx -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.61: Retroviral matrix proteins [47835] (1 superfamily) Superfamily a.61.1: Retroviral matrix proteins [47836] (4 families) 
Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (2 proteins) 
Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (3 PDB entries) 
Domain d2hmx__: 2hmx - [18129]
Details for d2hmx__
PDB Entry: 2hmx (more details)
PDB Description: human immunodeficiency virus type 1 matrix protein
SCOP Domain Sequences for d2hmx__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmx__ a.61.1.1 (-) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1}
hmgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrq
ilgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaa
adtgnnsqvsqny
SCOP Domain Coordinates for d2hmx__:
Click to download the PDB-style file with coordinates for d2hmx__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hmx__:
- d2hmx__ appears in SCOP 1.57
- d2hmx__ appears in the current release, SCOPe 2.08, called d2hmxa_
View in 3D