SCOPe 2.07: Domain d2gjwc1: 2gjw C:63-141

Lineage for d2gjwc1 (2gjw C:63-141)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.2: tRNA-intron endonuclease catalytic domain-like [53032] (1 family)

5. Family c.52.2.1: tRNA-intron endonuclease catalytic domain-like [53033] (3 proteins)

6. Protein Dimeric tRNA splicing endonuclease, domains 2 and 4 [102477] (1 species)
   duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats

7. Species Archaeoglobus fulgidus [TaxId:2234] [102478] (4 PDB entries)

8. Domain d2gjwc1: 2gjw C:63-141 [135303]
   Other proteins in same PDB: d2gjwa3, d2gjwa4, d2gjwa5, d2gjwb3, d2gjwb4, d2gjwb5, d2gjwc3, d2gjwc4, d2gjwc5, d2gjwd3, d2gjwd4
   automatically matched to d1r11a1
   protein/RNA complex

Details for d2gjwc1

PDB Entry: 2gjw, 2.85 Å

PDB Description: RNA Recognition and Cleavage by an Splicing Endonuclease

PDB Compounds: (C:) tRNA-splicing endonuclease

SCOPe Domain Sequences for d2gjwc1:

Sequence; same for both SEQRES and ATOM records:

>d2gjwc1 c.52.2.1 (C:63-141) Dimeric tRNA splicing endonuclease, domains 2 and 4 {Archaeoglobus fulgidus [TaxId: 2234]}
edfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrla
vvdeeseityfrvyepdmm

Timeline for d2gjwc1:

• d2gjwc1 first appeared in SCOP 1.73
  
• d2gjwc1 appears in SCOPe 2.06
  
• d2gjwc1 appears in the current release, SCOPe 2.08