Lineage for d2gjwa1 (2gjw A:64-142)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490815Superfamily c.52.2: tRNA-intron endonuclease catalytic domain-like [53032] (1 family) (S)
  5. 2490816Family c.52.2.1: tRNA-intron endonuclease catalytic domain-like [53033] (3 proteins)
  6. 2490817Protein Dimeric tRNA splicing endonuclease, domains 2 and 4 [102477] (1 species)
    duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats
  7. 2490818Species Archaeoglobus fulgidus [TaxId:2234] [102478] (4 PDB entries)
  8. 2490831Domain d2gjwa1: 2gjw A:64-142 [135295]
    Other proteins in same PDB: d2gjwa3, d2gjwa4, d2gjwa5, d2gjwb3, d2gjwb4, d2gjwb5, d2gjwc3, d2gjwc4, d2gjwc5, d2gjwd3, d2gjwd4
    automatically matched to d1r11a1
    protein/RNA complex

Details for d2gjwa1

PDB Entry: 2gjw (more details), 2.85 Å

PDB Description: RNA Recognition and Cleavage by an Splicing Endonuclease
PDB Compounds: (A:) tRNA-splicing endonuclease

SCOPe Domain Sequences for d2gjwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjwa1 c.52.2.1 (A:64-142) Dimeric tRNA splicing endonuclease, domains 2 and 4 {Archaeoglobus fulgidus [TaxId: 2234]}
edfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrla
vvdeeseityfrvyepdmm

SCOPe Domain Coordinates for d2gjwa1:

Click to download the PDB-style file with coordinates for d2gjwa1.
(The format of our PDB-style files is described here.)

Timeline for d2gjwa1: