SCOPe 2.08: Domain d2gjvd2: 2gjv D:1-134

Lineage for d2gjvd2 (2gjv D:1-134)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.323: Phage tail protein-like [143748] (1 superfamily)
   alpha-beta-X-beta(2)-alpha-beta(2); 2 layers: a/b; mixed beta-sheet: order 12354, strands 1 and 2 are parallel

4. Superfamily d.323.1: Phage tail protein-like [143749] (2 families)
   Can form ring, tube-like oligomers, where the subunit beta-sheets are joined in a single beta-sheet (or barrel)

5. Family d.323.1.2: STM4215-like [143753] (1 protein)
   automatically mapped to Pfam PF09646

6. Protein Putative cytoplasmic protein STM4215 [143754] (1 species)
   forms a ring-like hexamer; possible prophage protein

7. Species Salmonella typhimurium [TaxId:90371] [143755] (1 PDB entry)
   Uniprot Q8ZKJ0 1-134

8. Domain d2gjvd2: 2gjv D:1-134 [135292]
   Other proteins in same PDB: d2gjva2, d2gjvb3, d2gjvc3, d2gjvd3, d2gjve3, d2gjvf3
   automated match to d2gjva1
   complexed with ca, cl

Details for d2gjvd2

PDB Entry: 2gjv, 2.39 Å

PDB Description: crystal structure of a protein of unknown function from salmonella typhimurium

PDB Compounds: (D:) putative cytoplasmic protein

SCOPe Domain Sequences for d2gjvd2:

Sequence; same for both SEQRES and ATOM records:

>d2gjvd2 d.323.1.2 (D:1-134) Putative cytoplasmic protein STM4215 {Salmonella typhimurium [TaxId: 90371]}
metlsvihtvanrlrelnpdmdihisstdakvyiptgqqvtvlihycgsvfaepentdat
vqkqlirisatvivpqisdainaldrlrrslggielpdcdrplwlesekyigdaanfcry
aldmtastlfiaeq

Timeline for d2gjvd2:

• d2gjvd2 first appeared in SCOP 1.73, called d2gjvd1
  
• d2gjvd2 appears in SCOPe 2.07