![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.323: Phage tail protein-like [143748] (1 superfamily) alpha-beta-X-beta(2)-alpha-beta(2); 2 layers: a/b; mixed beta-sheet: order 12354, strands 1 and 2 are parallel |
![]() | Superfamily d.323.1: Phage tail protein-like [143749] (2 families) ![]() Can form ring, tube-like oligomers, where the subunit beta-sheets are joined in a single beta-sheet (or barrel) |
![]() | Family d.323.1.2: STM4215-like [143753] (1 protein) automatically mapped to Pfam PF09646 |
![]() | Protein Putative cytoplasmic protein STM4215 [143754] (1 species) forms a ring-like hexamer; possible prophage protein |
![]() | Species Salmonella typhimurium [TaxId:90371] [143755] (1 PDB entry) Uniprot Q8ZKJ0 1-134 |
![]() | Domain d2gjvc2: 2gjv C:1-134 [135291] Other proteins in same PDB: d2gjva2, d2gjvb3, d2gjvc3, d2gjvd3, d2gjve3, d2gjvf3 automated match to d2gjva1 complexed with ca, cl |
PDB Entry: 2gjv (more details), 2.39 Å
SCOPe Domain Sequences for d2gjvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gjvc2 d.323.1.2 (C:1-134) Putative cytoplasmic protein STM4215 {Salmonella typhimurium [TaxId: 90371]} metlsvihtvanrlrelnpdmdihisstdakvyiptgqqvtvlihycgsvfaepentdat vqkqlirisatvivpqisdainaldrlrrslggielpdcdrplwlesekyigdaanfcry aldmtastlfiaeq
Timeline for d2gjvc2: