PDB entry 2gjv

View 2gjv on RCSB PDB site
Description: Crystal Structure of a Protein of Unknown Function from Salmonella typhimurium
Class: structural genomics, unknown function
Keywords: Structural genomics, Unknown function, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2006-03-31, released 2006-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytoplasmic protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: NP_463080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKJ0 (24-End)
      • cloning artifact (22-23)
    Domains in SCOPe 2.08: d2gjva1, d2gjva2
  • Chain 'B':
    Compound: putative cytoplasmic protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: NP_463080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKJ0 (24-End)
      • cloning artifact (22-23)
    Domains in SCOPe 2.08: d2gjvb2, d2gjvb3
  • Chain 'C':
    Compound: putative cytoplasmic protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: NP_463080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKJ0 (24-End)
      • cloning artifact (22-23)
    Domains in SCOPe 2.08: d2gjvc2, d2gjvc3
  • Chain 'D':
    Compound: putative cytoplasmic protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: NP_463080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKJ0 (24-End)
      • cloning artifact (22-23)
    Domains in SCOPe 2.08: d2gjvd2, d2gjvd3
  • Chain 'E':
    Compound: putative cytoplasmic protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: NP_463080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKJ0 (24-End)
      • cloning artifact (22-23)
    Domains in SCOPe 2.08: d2gjve2, d2gjve3
  • Chain 'F':
    Compound: putative cytoplasmic protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: NP_463080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKJ0 (24-End)
      • cloning artifact (22-23)
    Domains in SCOPe 2.08: d2gjvf2, d2gjvf3
  • Heterogens: CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gjvA (A:)
    mhhhhhhssgvdlgtenlyfqsnametlsvihtvanrlrelnpdmdihisstdakvyipt
    gqqvtvlihycgsvfaepentdatvqkqlirisatvivpqisdainaldrlrrslggiel
    pdcdrplwlesekyigdaanfcryaldmtastlfiaeqeskdsplltivnyeeiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjvA (A:)
    nametlsvihtvanrlrelnpdmdihisstdakvyiptgqqvtvlihycgsvfaepentd
    atvqkqlirisatvivpqisdainaldrlrrslggielpdcdrplwlesekyigdaanfc
    ryaldmtastlfiaeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gjvB (B:)
    mhhhhhhssgvdlgtenlyfqsnametlsvihtvanrlrelnpdmdihisstdakvyipt
    gqqvtvlihycgsvfaepentdatvqkqlirisatvivpqisdainaldrlrrslggiel
    pdcdrplwlesekyigdaanfcryaldmtastlfiaeqeskdsplltivnyeeiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjvB (B:)
    nametlsvihtvanrlrelnpdmdihisstdakvyiptgqqvtvlihycgsvfaepentd
    atvqkqlirisatvivpqisdainaldrlrrslggielpdcdrplwlesekyigdaanfc
    ryaldmtastlfiaeq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gjvC (C:)
    mhhhhhhssgvdlgtenlyfqsnametlsvihtvanrlrelnpdmdihisstdakvyipt
    gqqvtvlihycgsvfaepentdatvqkqlirisatvivpqisdainaldrlrrslggiel
    pdcdrplwlesekyigdaanfcryaldmtastlfiaeqeskdsplltivnyeeiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjvC (C:)
    nametlsvihtvanrlrelnpdmdihisstdakvyiptgqqvtvlihycgsvfaepentd
    atvqkqlirisatvivpqisdainaldrlrrslggielpdcdrplwlesekyigdaanfc
    ryaldmtastlfiaeq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gjvD (D:)
    mhhhhhhssgvdlgtenlyfqsnametlsvihtvanrlrelnpdmdihisstdakvyipt
    gqqvtvlihycgsvfaepentdatvqkqlirisatvivpqisdainaldrlrrslggiel
    pdcdrplwlesekyigdaanfcryaldmtastlfiaeqeskdsplltivnyeeiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjvD (D:)
    nametlsvihtvanrlrelnpdmdihisstdakvyiptgqqvtvlihycgsvfaepentd
    atvqkqlirisatvivpqisdainaldrlrrslggielpdcdrplwlesekyigdaanfc
    ryaldmtastlfiaeq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gjvE (E:)
    mhhhhhhssgvdlgtenlyfqsnametlsvihtvanrlrelnpdmdihisstdakvyipt
    gqqvtvlihycgsvfaepentdatvqkqlirisatvivpqisdainaldrlrrslggiel
    pdcdrplwlesekyigdaanfcryaldmtastlfiaeqeskdsplltivnyeeiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjvE (E:)
    nametlsvihtvanrlrelnpdmdihisstdakvyiptgqqvtvlihycgsvfaepentd
    atvqkqlirisatvivpqisdainaldrlrrslggielpdcdrplwlesekyigdaanfc
    ryaldmtastlfiaeq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gjvF (F:)
    mhhhhhhssgvdlgtenlyfqsnametlsvihtvanrlrelnpdmdihisstdakvyipt
    gqqvtvlihycgsvfaepentdatvqkqlirisatvivpqisdainaldrlrrslggiel
    pdcdrplwlesekyigdaanfcryaldmtastlfiaeqeskdsplltivnyeeiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjvF (F:)
    nametlsvihtvanrlrelnpdmdihisstdakvyiptgqqvtvlihycgsvfaepentd
    atvqkqlirisatvivpqisdainaldrlrrslggielpdcdrplwlesekyigdaanfc
    ryaldmtastlfiaeq