Lineage for d2gjve2 (2gjv E:1-134)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010942Fold d.323: Phage tail protein-like [143748] (1 superfamily)
    alpha-beta-X-beta(2)-alpha-beta(2); 2 layers: a/b; mixed beta-sheet: order 12354, strands 1 and 2 are parallel
  4. 3010943Superfamily d.323.1: Phage tail protein-like [143749] (2 families) (S)
    Can form ring, tube-like oligomers, where the subunit beta-sheets are joined in a single beta-sheet (or barrel)
  5. 3010972Family d.323.1.2: STM4215-like [143753] (1 protein)
    automatically mapped to Pfam PF09646
  6. 3010973Protein Putative cytoplasmic protein STM4215 [143754] (1 species)
    forms a ring-like hexamer; possible prophage protein
  7. 3010974Species Salmonella typhimurium [TaxId:90371] [143755] (1 PDB entry)
    Uniprot Q8ZKJ0 1-134
  8. 3010979Domain d2gjve2: 2gjv E:1-134 [135293]
    Other proteins in same PDB: d2gjva2, d2gjvb3, d2gjvc3, d2gjvd3, d2gjve3, d2gjvf3
    automated match to d2gjva1
    complexed with ca, cl

Details for d2gjve2

PDB Entry: 2gjv (more details), 2.39 Å

PDB Description: crystal structure of a protein of unknown function from salmonella typhimurium
PDB Compounds: (E:) putative cytoplasmic protein

SCOPe Domain Sequences for d2gjve2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjve2 d.323.1.2 (E:1-134) Putative cytoplasmic protein STM4215 {Salmonella typhimurium [TaxId: 90371]}
metlsvihtvanrlrelnpdmdihisstdakvyiptgqqvtvlihycgsvfaepentdat
vqkqlirisatvivpqisdainaldrlrrslggielpdcdrplwlesekyigdaanfcry
aldmtastlfiaeq

SCOPe Domain Coordinates for d2gjve2:

Click to download the PDB-style file with coordinates for d2gjve2.
(The format of our PDB-style files is described here.)

Timeline for d2gjve2: