Lineage for d2ghpc1 (2ghp C:116-196)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952311Protein U4/U6 snRNA-associated-splicing factor PRP24 [143338] (1 species)
    contains three RBDs
  7. 2952312Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143339] (2 PDB entries)
    Uniprot P49960 116-196! Uniprot P49960 206-291! Uniprot P49960 41-115
  8. 2952319Domain d2ghpc1: 2ghp C:116-196 [135190]
    automated match to d2ghpa1

Details for d2ghpc1

PDB Entry: 2ghp (more details), 2.7 Å

PDB Description: crystal structure of the n-terminal 3 rna binding domains of the yeast splicing factor prp24
PDB Compounds: (C:) U4/U6 snRNA-associated splicing factor PRP24

SCOPe Domain Sequences for d2ghpc1:

Sequence, based on SEQRES records: (download)

>d2ghpc1 d.58.7.1 (C:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ectlwmtnfppsytqrnirdllqdinvvalsirlpslrfntsrrfayidvtskedarycv
eklnglkiegytlvtkvsnpl

Sequence, based on observed residues (ATOM records): (download)

>d2ghpc1 d.58.7.1 (C:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ectlwmtnfppsytqrnirdllqdinvvalsirlprrfayidvtskedarycveklnglk
iegytlvtkvsnpl

SCOPe Domain Coordinates for d2ghpc1:

Click to download the PDB-style file with coordinates for d2ghpc1.
(The format of our PDB-style files is described here.)

Timeline for d2ghpc1: