Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein U4/U6 snRNA-associated-splicing factor PRP24 [143338] (1 species) contains three RBDs |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143339] (2 PDB entries) Uniprot P49960 116-196! Uniprot P49960 206-291! Uniprot P49960 41-115 |
Domain d2ghpb1: 2ghp B:116-196 [135187] automated match to d2ghpa1 |
PDB Entry: 2ghp (more details), 2.7 Å
SCOPe Domain Sequences for d2ghpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ghpb1 d.58.7.1 (B:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ectlwmtnfppsytqrnirdllqdinvvalsirlpslrfntsrrfayidvtskedarycv eklnglkiegytlvtkvsnpl
Timeline for d2ghpb1: