SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ghpd3 (2ghp D:206-291)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2174486Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2174487Family d.58.7.1: Canonical RBD [54929] (68 protein domains)
  6. 2174914Protein U4/U6 snRNA-associated-splicing factor PRP24 [143338] (1 species)
    contains three RBDs
  7. 2174915Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143339] (2 PDB entries)
    Uniprot P49960 116-196! Uniprot P49960 206-291! Uniprot P49960 41-115
  8. 2174927Domain d2ghpd3: 2ghp D:206-291 [135195]
    automated match to d2ghpa3

Details for d2ghpd3

PDB Entry: 2ghp (more details), 2.7 Å

PDB Description: Crystal structure of the N-terminal 3 RNA binding domains of the yeast splicing factor Prp24
PDB Compounds: (D:) U4/U6 snRNA-associated splicing factor PRP24

SCOPe Domain Sequences for d2ghpd3:

Sequence, based on SEQRES records: (download)

>d2ghpd3 d.58.7.1 (D:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlegreimirnlstelldenllresfegfgsiekinipagqkehsfnnccafmvfenkds
aeralqmnrsllgnreisvsladkkp

Sequence, based on observed residues (ATOM records): (download)

>d2ghpd3 d.58.7.1 (D:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlegreimirnlstelldenllresfegfgsiekinipagqkfnnccafmvfenkdsaer
alqmnrsllgnreisvsladkkp

SCOPe Domain Coordinates for d2ghpd3:

Click to download the PDB-style file with coordinates for d2ghpd3.
(The format of our PDB-style files is described here.)

Timeline for d2ghpd3: