![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein U4/U6 snRNA-associated-splicing factor PRP24 [143338] (1 species) contains three RBDs |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143339] (2 PDB entries) Uniprot P49960 116-196! Uniprot P49960 206-291! Uniprot P49960 41-115 |
![]() | Domain d2ghpa1: 2ghp A:116-196 [135184] |
PDB Entry: 2ghp (more details), 2.7 Å
SCOPe Domain Sequences for d2ghpa1:
Sequence, based on SEQRES records: (download)
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ectlwmtnfppsytqrnirdllqdinvvalsirlpslrfntsrrfayidvtskedarycv eklnglkiegytlvtkvsnpl
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ectlwmtnfppsytqrnirdllqdinvvalsirlprrfayidvtskedarycveklnglk iegytlvtkvsnpl
Timeline for d2ghpa1: