Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
Protein Envelope glycoprotein [49213] (5 species) |
Domain d2gg1a1: 2gg1 A:303-395 [135119] |
PDB Entry: 2gg1 (more details)
SCOPe Domain Sequences for d2gg1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gg1a1 b.1.18.4 (A:303-395) Envelope glycoprotein {Langat virus [TaxId: 11085]} tytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevnvamlitpnp tmenngggfiemqlppgdniiyvgdlnhqwfqk
Timeline for d2gg1a1: