Lineage for d2gg1a1 (2gg1 A:303-395)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765451Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2765452Protein Envelope glycoprotein [49213] (5 species)
  7. Species Langat virus [TaxId:11085] [141022] (1 PDB entry)
    Uniprot P29838 583-765
  8. 2765476Domain d2gg1a1: 2gg1 A:303-395 [135119]

Details for d2gg1a1

PDB Entry: 2gg1 (more details)

PDB Description: nmr solution structure of domain iii of the e-protein of tick-borne langat flavivirus (includes rdc restraints)
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d2gg1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gg1a1 b.1.18.4 (A:303-395) Envelope glycoprotein {Langat virus [TaxId: 11085]}
tytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevnvamlitpnp
tmenngggfiemqlppgdniiyvgdlnhqwfqk

SCOPe Domain Coordinates for d2gg1a1:

Click to download the PDB-style file with coordinates for d2gg1a1.
(The format of our PDB-style files is described here.)

Timeline for d2gg1a1: