PDB entry 2gg1

View 2gg1 on RCSB PDB site
Description: NMR solution structure of domain III of the E-protein of tick-borne Langat flavivirus (includes RDC restraints)
Class: viral protein
Keywords: Viral protein, Domain III
Deposited on 2006-03-23, released 2006-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Langat virus [TaxId:11085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gg1a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gg1A (A:)
    gsefgskgltytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevn
    vamlitpnptmenngggfiemqlppgdniiyvgdlnhqwfqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gg1A (A:)
    tytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevnvamlitpnp
    tmenngggfiemqlppgdniiyvgdlnhqwfqk