![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
![]() | Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
![]() | Family a.77.1.2: DEATH domain, DD [81312] (9 proteins) Pfam PF00531 |
![]() | Protein FADD (Mort1) [47992] (2 species) contains two domains of this superfamily: DED and DD, in this order |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47993] (4 PDB entries) |
![]() | Domain d2gf5a1: 2gf5 A:89-191 [135075] Other proteins in same PDB: d2gf5a2, d2gf5a3 automatically matched to d1e3ya_ |
PDB Entry: 2gf5 (more details)
SCOPe Domain Sequences for d2gf5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gf5a1 a.77.1.2 (A:89-191) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]} gaapgeedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriw kntekenatvahlvgalrscqmnlvadlvqevqqardlqnrsg
Timeline for d2gf5a1: