PDB entry 2gf5

View 2gf5 on RCSB PDB site
Description: Structure of intact FADD (MORT1)
Class: apoptosis
Keywords: Death domain, death effector domain, apoptosis, death-inducing signaling complex
Deposited on 2006-03-21, released 2006-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fadd protein
    Species: Homo sapiens [TaxId:9606]
    Gene: FADD, MORT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13158 (1-190)
      • cloning artifact (0)
      • engineered (24)
    Domains in SCOPe 2.08: d2gf5a1, d2gf5a2, d2gf5a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gf5A (A:)
sdpflvllhsvssslssseltelkylclgrvgkrklervqsgldlfsmlleqndlepght
ellrellaslrrhdllrrvddfeagaaagaapgeedlcaafnvicdnvgkdwrrlarqlk
vsdtkidsiedryprnltervreslriwkntekenatvahlvgalrscqmnlvadlvqev
qqardlqnrsg