![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
![]() | Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
![]() | Family a.77.1.4: DEATH effector domain, DED [81388] (2 proteins) |
![]() | Protein FADD (Mort1) [81387] (1 species) contains two domains of this superfamily: DED and DD, in this order |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81386] (3 PDB entries) |
![]() | Domain d2gf5a2: 2gf5 A:2-83 [135076] Other proteins in same PDB: d2gf5a1, d2gf5a3 automatically matched to d1a1w__ |
PDB Entry: 2gf5 (more details)
SCOPe Domain Sequences for d2gf5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gf5a2 a.77.1.4 (A:2-83) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]} dpflvllhsvssslssseltelkylclgrvgkrklervqsgldlfsmlleqndlepghte llrellaslrrhdllrrvddfe
Timeline for d2gf5a2: