Lineage for d2gf5a2 (2gf5 A:2-83)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2719039Family a.77.1.4: DEATH effector domain, DED [81388] (2 proteins)
  6. 2719040Protein FADD (Mort1) [81387] (1 species)
    contains two domains of this superfamily: DED and DD, in this order
  7. 2719041Species Human (Homo sapiens) [TaxId:9606] [81386] (3 PDB entries)
  8. 2719042Domain d2gf5a2: 2gf5 A:2-83 [135076]
    Other proteins in same PDB: d2gf5a1, d2gf5a3
    automatically matched to d1a1w__

Details for d2gf5a2

PDB Entry: 2gf5 (more details)

PDB Description: structure of intact fadd (mort1)
PDB Compounds: (A:) fadd protein

SCOPe Domain Sequences for d2gf5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf5a2 a.77.1.4 (A:2-83) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]}
dpflvllhsvssslssseltelkylclgrvgkrklervqsgldlfsmlleqndlepghte
llrellaslrrhdllrrvddfe

SCOPe Domain Coordinates for d2gf5a2:

Click to download the PDB-style file with coordinates for d2gf5a2.
(The format of our PDB-style files is described here.)

Timeline for d2gf5a2: