Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.6: Phenolic acid decarboxylase (PAD) [141469] (2 proteins) Pfam PF05870; dimeric enzyme made of lipocalin-like subunits |
Protein P-coumaric acid decarboxylase, pdc [141470] (1 species) |
Species Lactobacillus plantarum [TaxId:1590] [141471] (2 PDB entries) Uniprot Q88RY7 1-178 |
Domain d2gc9a1: 2gc9 A:1-178 [134972] Other proteins in same PDB: d2gc9b2 complexed with cit, edo, so4 |
PDB Entry: 2gc9 (more details), 1.7 Å
SCOPe Domain Sequences for d2gc9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc9a1 b.60.1.6 (A:1-178) P-coumaric acid decarboxylase, pdc {Lactobacillus plantarum [TaxId: 1590]} mtktfktlddflgthfiytydngweyewyakndhtvdyrihggmvagrwvtdqkadivml tegiykiswteptgtdvaldfmpnekklhgtiffpkwveehpeitvtyqnehidlmeqsr ekyatypklvvpefanitymgdagqnnedviseapykempndirngkyfdqnyhrlnk
Timeline for d2gc9a1: