Lineage for d2gc9a1 (2gc9 A:1-178)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 674100Family b.60.1.6: Phenolic acid decarboxylase (PAD) [141469] (1 protein)
    Pfam PF05870; dimeric enzyme made of lipocalin-like subunits
  6. 674101Protein P-coumaric acid decarboxylase, pdc [141470] (1 species)
  7. 674102Species Lactobacillus plantarum [TaxId:1590] [141471] (1 PDB entry)
  8. 674103Domain d2gc9a1: 2gc9 A:1-178 [134972]
    complexed with cit, edo, so4

Details for d2gc9a1

PDB Entry: 2gc9 (more details), 1.7 Å

PDB Description: Crystal structure of p-coumaric acid decarboxylase (NP_786857.1) from Lactobacillus plantarum at 1.70 A resolution
PDB Compounds: (A:) p-coumaric acid decarboxylase

SCOP Domain Sequences for d2gc9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc9a1 b.60.1.6 (A:1-178) P-coumaric acid decarboxylase, pdc {Lactobacillus plantarum [TaxId: 1590]}
mtktfktlddflgthfiytydngweyewyakndhtvdyrihggmvagrwvtdqkadivml
tegiykiswteptgtdvaldfmpnekklhgtiffpkwveehpeitvtyqnehidlmeqsr
ekyatypklvvpefanitymgdagqnnedviseapykempndirngkyfdqnyhrlnk

SCOP Domain Coordinates for d2gc9a1:

Click to download the PDB-style file with coordinates for d2gc9a1.
(The format of our PDB-style files is described here.)

Timeline for d2gc9a1: