Class b: All beta proteins [48724] (178 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) |
Family b.69.2.0: automated matches [232760] (1 protein) not a true family |
Protein automated matches [232762] (1 species) not a true protein |
Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries) |
Domain d2gc4m_: 2gc4 M: [134946] Other proteins in same PDB: d2gc4b_, d2gc4c_, d2gc4d_, d2gc4f_, d2gc4g_, d2gc4h_, d2gc4j_, d2gc4k_, d2gc4l_, d2gc4n_, d2gc4o_, d2gc4p_ automated match to d3l4od_ complexed with cu, hem, na |
PDB Entry: 2gc4 (more details), 1.9 Å
SCOPe Domain Sequences for d2gc4m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc4m_ b.69.2.0 (M:) automated matches {Paracoccus denitrificans [TaxId: 318586]} eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvi dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg eelrsvnqlghgpqvittadmg
Timeline for d2gc4m_: