Lineage for d2gc4d_ (2gc4 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304334Protein Cytochrome c551 [46660] (5 species)
  7. 2304337Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries)
  8. 2304338Domain d2gc4d_: 2gc4 D: [134937]
    Other proteins in same PDB: d2gc4a_, d2gc4b_, d2gc4c_, d2gc4e_, d2gc4f_, d2gc4g_, d2gc4i_, d2gc4j_, d2gc4k_, d2gc4m_, d2gc4n_, d2gc4o_
    automated match to d1mg2d_
    complexed with cu, hem, na

Details for d2gc4d_

PDB Entry: 2gc4 (more details), 1.9 Å

PDB Description: structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
PDB Compounds: (D:) cytochrome c-l

SCOPe Domain Sequences for d2gc4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc4d_ a.3.1.1 (D:) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]}
apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
rhlytgdpkdaswltdeqkagftpfqp

SCOPe Domain Coordinates for d2gc4d_:

Click to download the PDB-style file with coordinates for d2gc4d_.
(The format of our PDB-style files is described here.)

Timeline for d2gc4d_: