| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (8 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Cow (Bos taurus) [TaxId:9913] [47958] (8 PDB entries) |
| Domain d2g9xd1: 2g9x D:181-308 [134848] Other proteins in same PDB: d2g9xa_, d2g9xc_ automatically matched to d1vin_1 complexed with nu5 |
PDB Entry: 2g9x (more details), 2.5 Å
SCOPe Domain Sequences for d2g9xd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g9xd1 a.74.1.1 (D:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vlafdlaa
Timeline for d2g9xd1:
View in 3DDomains from other chains: (mouse over for more information) d2g9xa_, d2g9xb1, d2g9xb2, d2g9xc_ |