Lineage for d2g9xd1 (2g9x D:181-308)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644042Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 644043Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 644044Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 644055Protein Cyclin A [47956] (2 species)
  7. 644056Species Cow (Bos taurus) [TaxId:9913] [47958] (19 PDB entries)
  8. 644113Domain d2g9xd1: 2g9x D:181-308 [134848]
    Other proteins in same PDB: d2g9xa1, d2g9xc1
    automatically matched to d1vin_1
    complexed with nu5

Details for d2g9xd1

PDB Entry: 2g9x (more details), 2.5 Å

PDB Description: Structure of Thr 160 phosphorylated CDK2/cyclin A in complex with the inhibitor NU6271
PDB Compounds: (D:) Cyclin-A2

SCOP Domain Sequences for d2g9xd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g9xd1 a.74.1.1 (D:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vlafdlaa

SCOP Domain Coordinates for d2g9xd1:

Click to download the PDB-style file with coordinates for d2g9xd1.
(The format of our PDB-style files is described here.)

Timeline for d2g9xd1: