![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Cyclin A [47956] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries) |
![]() | Domain d2g9xd1: 2g9x D:172-309 [134848] Other proteins in same PDB: d2g9xa2, d2g9xa3, d2g9xb3, d2g9xc2, d2g9xc3, d2g9xd3 automated match to d1finb1 complexed with nu5 |
PDB Entry: 2g9x (more details), 2.5 Å
SCOPe Domain Sequences for d2g9xd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g9xd1 a.74.1.1 (D:172-309) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} vnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnet lhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqv lrmehlvlkvlafdlaap
Timeline for d2g9xd1: