| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
| Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (12 PDB entries) |
| Domain d2g9hb2: 2g9h B:1-92 [134805] Other proteins in same PDB: d2g9ha1, d2g9ha2, d2g9hb1, d2g9hd1, d2g9hd2 automatically matched to d1d5xb2 complexed with dio, epe, so4, zn |
PDB Entry: 2g9h (more details), 2 Å
SCOPe Domain Sequences for d2g9hb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g9hb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq
Timeline for d2g9hb2:
View in 3DDomains from other chains: (mouse over for more information) d2g9ha1, d2g9ha2, d2g9hd1, d2g9hd2 |