Lineage for d1d5xb2 (1d5x B:1-92)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1021417Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1021470Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (12 PDB entries)
  8. 1021479Domain d1d5xb2: 1d5x B:1-92 [38198]
    Other proteins in same PDB: d1d5xa1, d1d5xa2, d1d5xb1, d1d5xc1, d1d5xc2

Details for d1d5xb2

PDB Entry: 1d5x (more details), 2.45 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with dipeptide mimetic and seb
PDB Compounds: (B:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1d5xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5xb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaey
wnsqkdlleqkraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1d5xb2:

Click to download the PDB-style file with coordinates for d1d5xb2.
(The format of our PDB-style files is described here.)

Timeline for d1d5xb2:

1021479
d1d5xb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1d5xb1