SCOPe 2.08: Domain d2g9hb2: 2g9h B:1-92

Lineage for d2g9hb2 (2g9h B:1-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (9 PDB entries)

8. Domain d2g9hb2: 2g9h B:1-92 [134805]
   Other proteins in same PDB: d2g9ha1, d2g9ha2, d2g9ha3, d2g9hb1, d2g9hd1, d2g9hd2
   automatically matched to d1d5xb2
   complexed with dio, epe, so4, zn
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2g9hb2

PDB Entry: 2g9h, 2 Å

PDB Description: crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2g9hb2:

Sequence; same for both SEQRES and ATOM records:

>d2g9hb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d2g9hb2:

• d2g9hb2 first appeared in SCOP 1.73
  
• d2g9hb2 appears in SCOPe 2.07