![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein) automatically mapped to Pfam PF00648 |
![]() | Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species) includes the N-terminal 'sequence' domain I |
![]() | Species Norway rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (10 PDB entries) Uniprot P97571 33-353 |
![]() | Domain d2g8ea2: 2g8e A:33-356 [134769] Other proteins in same PDB: d2g8ea3 automated match to d1tloa_ complexed with 0m6, ca, mes |
PDB Entry: 2g8e (more details), 2.25 Å
SCOPe Domain Sequences for d2g8ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g8ea2 d.3.1.3 (A:33-356) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]} naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg efwmsfrdfireftkleicnltpd
Timeline for d2g8ea2: