SCOPe 2.08: Domain d2g8ea2: 2g8e A:33-356

Lineage for d2g8ea2 (2g8e A:33-356)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
   automatically mapped to Pfam PF00648

6. Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species)
   includes the N-terminal 'sequence' domain I

7. Species Norway rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (10 PDB entries)
   Uniprot P97571 33-353

8. Domain d2g8ea2: 2g8e A:33-356 [134769]
   Other proteins in same PDB: d2g8ea3
   automated match to d1tloa_
   complexed with 0m6, ca, mes

Details for d2g8ea2

PDB Entry: 2g8e, 2.25 Å

PDB Description: calpain 1 proteolytic core in complex with snj-1715, a cyclic hemiacetal-type inhibitor

PDB Compounds: (A:) Calpain-1 catalytic subunit

SCOPe Domain Sequences for d2g8ea2:

Sequence; same for both SEQRES and ATOM records:

>d2g8ea2 d.3.1.3 (A:33-356) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]}
naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq
lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse
afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh
aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg
efwmsfrdfireftkleicnltpd

Timeline for d2g8ea2:

• d2g8ea2 first appeared in SCOP 1.73, called d2g8ea1
  
• d2g8ea2 appears in SCOPe 2.07